GeneBio Systems
Recombinant Mouse Membrane cofactor protein (Cd46), partial
Recombinant Mouse Membrane cofactor protein (Cd46), partial
SKU:O88174
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: O88174
Gene Names: Cd46
Alternative Name(s): CD46
Abbreviation: Recombinant Mouse Cd46 protein, partial
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 45-329aa
Protein Length: Extracellular Domain
Tag Info: N-terminal 6xHis-tagged
Target Protein Sequence: CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW
MW: 35.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
Reference: Disruption of mouse CD46 causes an accelerated spontaneous acrosome reaction in sperm.Inoue N., Ikawa M., Nakanishi T., Matsumoto M., Nomura M., Seya T., Okabe M.Mol. Cell. Biol. 23: 2614-2622(2003)
Function: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
