Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Membrane-associated progesterone receptor component 1(Pgrmc1)

Recombinant Mouse Membrane-associated progesterone receptor component 1(Pgrmc1)

SKU:CSB-CF017876MO

Regular price $1,850.00 USD
Regular price Sale price $1,850.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O55022

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDETARKNE

Protein Names:Recommended name: Membrane-associated progesterone receptor component 1

Gene Names:Name:Pgrmc1 Synonyms:Pgrmc

Expression Region:2-195

Sequence Info:full length protein

View full details