Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1(Klrg1)

Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1(Klrg1)

SKU:CSB-CF012472MO

Regular price $1,789.00 USD
Regular price Sale price $1,789.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O88713

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADSSIYSTLELPEAPQVQDESRWKLKAVLHRPHLSRFAMVALGLLTVILMSLLMYQRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY

Protein Names:Recommended name: Killer cell lectin-like receptor subfamily G member 1 Alternative name(s): Mast cell function-associated antigen 2F1

Gene Names:Name:Klrg1 Synonyms:Mafa

Expression Region:1-188

Sequence Info:full length protein

View full details