Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Interleukin-3 receptor subunit alpha(Il3ra)

Recombinant Mouse Interleukin-3 receptor subunit alpha(Il3ra)

SKU:CSB-CF011658MO

Regular price $2,085.00 USD
Regular price Sale price $2,085.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P26952

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLLYRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA

Protein Names:Recommended name: Interleukin-3 receptor subunit alpha Short name= IL-3 receptor subunit alpha Short name= IL-3R subunit alpha Short name= IL-3R-alpha Short name= IL-3RA Alternative name(s): Interleukin-3 receptor class II alpha chain CD_antigen= CD123

Gene Names:Name:Il3ra Synonyms:Sut-1

Expression Region:17-396

Sequence Info:full length protein

View full details