Gene Bio Systems
Recombinant Mouse Interferon-induced transmembrane protein 5(Ifitm5)
Recombinant Mouse Interferon-induced transmembrane protein 5(Ifitm5)
SKU:CSB-CF011028MO-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O88728
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDTSYPREDPRAPSSRKADAAAHTALSMGTPGPTPRDHMLWSVFSTMYLNLCCLGFLALV HSVKARDQKMAGNLEAARQYGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLSKLAKDS AAFFSTKFDEEDYN
Protein Names:Recommended name: Interferon-induced transmembrane protein 5 Alternative name(s): Bone-restricted interferon-induced transmembrane protein-like protein Short name= Bril Fragilis family member 4
Gene Names:Name:Ifitm5 Synonyms:Bril, Fragilis4
Expression Region:1-134
Sequence Info:Full length protein
