Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Hemoglobin subunit beta-2(Hbb-b2)

Recombinant Mouse Hemoglobin subunit beta-2(Hbb-b2)

SKU:CSB-EP360812MO

Regular price $1,050.00 USD
Regular price Sale price $1,050.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P02089

Gene Names: Hbb-b2

Organism: Mus musculus (Mouse)

AA Sequence: VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Expression Region: 2-147aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 42.7 kDa

Alternative Name(s): Beta-2-globinHemoglobin beta-2 chainHemoglobin beta-minor chain

Relevance: Involved in oxygen transport from the lung to the various peripheral tissues.

Reference: SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details