Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse H-2 class I histocompatibility antigen, K-D alpha chain(H2-K1),partial

Recombinant Mouse H-2 class I histocompatibility antigen, K-D alpha chain(H2-K1),partial

SKU:CSB-EP355780MO

Regular price $1,059.00 USD
Regular price Sale price $1,059.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P01902

Gene Names: H2-K1

Organism: Mus musculus (Mouse)

AA Sequence: GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKLPPSTVSNT

Expression Region: 22-305aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 60 kDa

Alternative Name(s):

Relevance: Involved in the presentation of foreign antigens to the immune syst.

Reference: The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details