Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse FXYD domain-containing ion transport regulator 7(Fxyd7)

Recombinant Mouse FXYD domain-containing ion transport regulator 7(Fxyd7)

SKU:CSB-CF009097MO

Regular price $1,655.00 USD
Regular price Sale price $1,655.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P59648

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIILSKKVKCRKADSRSES PTCKSCKSELPSSAPGGGGV

Protein Names:Recommended name: FXYD domain-containing ion transport regulator 7

Gene Names:Name:Fxyd7

Expression Region:1-80

Sequence Info:Full length protein

View full details