
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: Fgf21
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: Q9JJN1
AA Sequence: AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Tag info: N-terminal 6xHis-tagged
Expression Region: 29-210aa
Protein length: Full Length
MW: 23.9 kDa
Alternative Name(s):
Relevance: Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB.
Reference: Identification of a novel FGF, FGF-21, preferentially expressed in the liver.Nishimura T., Nakatake Y., Konishi M., Itoh N.Biochim. Biophys. Acta 1492:203-206(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Fibroblast growth factor 21(Fgf21)
- Regular price
- $779.00 USD
- Sale price
- $779.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Fibroblast growth factor 21 protein(FGF-21)
- Regular price
- $609.00 USD
- Sale price
- $609.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Fibroblast growth factor 15(Fgf15)
- Regular price
- $779.00 USD
- Sale price
- $779.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Fibroblast growth factor 1(Fgf1)
- Regular price
- $779.00 USD
- Sale price
- $779.00 USD
- Regular price
-
- Unit price
- per
Sold out