Recombinant Mouse EEF1A lysine methyltransferase 2(Eef1akmt2)

Recombinant Mouse EEF1A lysine methyltransferase 2(Eef1akmt2)

CSB-EP880522MO
Regular price
$900.00 USD
Sale price
$900.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:others

Uniprot ID:Q9D853

Gene Names:Eef1akmt2

Organism:Mus musculus (Mouse)

AA Sequence:MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS

Expression Region:1-244aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 10xHis-tagged

MW:32.9 kDa

Alternative Name(s):EEF1A lysine methyltransferase 2(EC 2.1.1.-)(Methyltransferase-like protein 10)(Protein-lysine N-methyltransferase Mettl10)

Relevance:Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'.

Reference:"Head bobber: an insertional mutation causes inner ear defects, hyperactive circling, and deafness." Somma G., Alger H.M., McGuire R.M., Kretlow J.D., Ruiz F.R., Yatsenko S.A., Stankiewicz P., Harrison W., Funk E., Bergamaschi A., Oghalai J.S., Mikos A.G., Overbeek P.A., Pereira F.A. J Assoc Res Otolaryngol 13:335-349(2012)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

Your list is ready to share