Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse E3 ubiquitin-protein ligase RNF185(Rnf185)

Recombinant Mouse E3 ubiquitin-protein ligase RNF185(Rnf185)

SKU:CSB-CF849684MO

Regular price $1,793.00 USD
Regular price Sale price $1,793.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q91YT2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCW PCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENR GGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLF VALVIMFWLLIA

Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF185 EC= 6.3.2.- Alternative name(s): RING finger protein 185

Gene Names:Name:Rnf185

Expression Region:1-192

Sequence Info:full length protein

View full details