Gene Bio Systems
Recombinant Mouse Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit(Ddost)
Recombinant Mouse Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit(Ddost)
SKU:CSB-CF006594MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O54734
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIIIEQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD
Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit Short name= DDOST 48 kDa subunit Short name= Oligosaccharyl transferase 48 kDa subunit EC= 2.4.1.119
Gene Names:Name:Ddost
Expression Region:29-441
Sequence Info:full length protein
