Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Cytochrome P450 2C70 (Cyp2c70)

Recombinant Mouse Cytochrome P450 2C70 (Cyp2c70)

SKU:Q91W64

Regular price $611.00 USD
Regular price Sale price $611.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: Q91W64

Gene Names: Cyp2c70

Alternative Name(s): CYPIIC70

Abbreviation: Recombinant Mouse Cyp2c70 protein

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 28-489aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: KLPPGPTPLPIVGNILQVDVKNISKSMGMLAKKYGPVFTVYLGMKPTVVLHGYKAMKEALIDQGDEFSDKTDSSLLSRTSQGLGIVFSNGETWKQTRRFSLMVLRSMGMGKKTIEDRIQEEILYMLDALRKTNGSPCDPSFLLACVPCNVISTVIFQHRFDYNDQTFQDFMENFHRKIEILASPWSQLCSAYPILYYLPGIHNRFLKDVTQQKKFILEEINRHQKSLDLSNPQDFIDYFLIKMEKEKHNQKSEFTMDNLVVSIGDLFGAGTETTSSTVKYGLLLLLKYPEVTAKIQEEIAHVIGRHRRPTMQDRNHMPYTDAVLHEIQRYIDFVPIPSPRKTTQDVEFRGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFVAFSAGRRACIGEGLARMEMFLILTNILQHFTLKPLVKPEDIDTKPVQTGLLHVPPPFELCFIPV

MW: 59.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: A cytochrome P450 monooxygenase involved in muricholic acid (MCA) synthesis. Hydroxylates at the 6-beta position two major bile acids, chenodeoxycholic acid (CDCA) and ursodeoxycholic acid (UDCA) to form alpha-MCA and beta-MCA, respectively. May regulate NR1H4/farnesoid X receptor signaling, as taurine-conjugated MCAs are antagonists of NR1H4. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).

Reference:

Function:

View full details