Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Cytochrome c1, heme protein, mitochondrial(Cyc1)

Recombinant Mouse Cytochrome c1, heme protein, mitochondrial(Cyc1)

SKU:CSB-CF875175MO

Regular price $1,895.00 USD
Regular price Sale price $1,895.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9D0M3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEE AKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRAR HGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMS QVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPP K

Protein Names:Recommended name: Cytochrome c1, heme protein, mitochondrial Alternative name(s): Complex III subunit 4 Complex III subunit IV Cytochrome b-c1 complex subunit 4 Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit Short n

Gene Names:Name:Cyc1

Expression Region:85-325

Sequence Info:full length protein

View full details