Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Cytochrome b561 domain-containing protein 1(Cyb561d1)

Recombinant Mouse Cytochrome b561 domain-containing protein 1(Cyb561d1)

SKU:CSB-CF006307MO

Regular price $1,901.00 USD
Regular price Sale price $1,901.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:A2AE42

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHSMEVGLVPAPAREPRLTRWLRRGSGILAHLIALGFTIFLTVLSRPGTSLFSWHPVFMA LAFCLCMAEAILLFSPEHSLFFFCSRKTRIRLHWAGQTMAILCAVLGLGFIISSKIRSEM SHLVSWHSWIGALTLLATGGQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVT VLLGMYSVWFQAQIKGTAWYLCLGLPLYPALVIMHQISSSYLPRKKVEI

Protein Names:Recommended name: Cytochrome b561 domain-containing protein 1

Gene Names:Name:Cyb561d1

Expression Region:1-229

Sequence Info:Full length protein

View full details