
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Metabolism
Uniprot ID: Q9ES30
Gene Names: C1qtnf3
Organism: Mus musculus (Mouse)
AA Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Expression Region: 23-246aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 31.1 kDa
Alternative Name(s): Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
Relevance:
Reference: "Role of specificity protein-1, PPARgamma, and pituitary protein transcription factor-1 in transcriptional regulation of the murine CORS-26 promoter." Schaffler A., Ehling A., Neumann E., Herfarth H., Paul G., Tarner I., Gay S., Buechler C., Scholmerich J., Muller-Ladner U. Biochim. Biophys. Acta 1678:150-156(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Complement C1q tumor necrosis factor-related protein 3(C1QTNF3)
- Regular price
- $609.00 USD
- Sale price
- $609.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Complement C1q subcomponent subunit A(C1qa)
- Regular price
- $779.00 USD
- Sale price
- $779.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Complement C1q subcomponent subunit A(C1qa)
- Regular price
- $776.00 USD
- Sale price
- $776.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Complement C1q subcomponent subunit A(C1qa)
- Regular price
- $916.00 USD
- Sale price
- $916.00 USD
- Regular price
-
- Unit price
- per
Sold out