GeneBio Systems
Recombinant Mouse Collagen alpha-1 (XVI) chain (Col16a1), partial
Recombinant Mouse Collagen alpha-1 (XVI) chain (Col16a1), partial
SKU:Q8BLX7
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Signal Transduction
Uniprot ID: Q8BLX7
Gene Names: Col16a1
Alternative Name(s): XVI
Abbreviation: Recombinant Mouse Col16a1 protein, partial
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 22-231aa
Protein Length: Partial
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: TNIGERCPTSQQEGLKLEHSSDPSTNVTGFNLIRRLNLMKTSAIKKIRNPKGPLILRLGAAPVTQPTRRVFPRGLPEEFALVLTVLLKKHTFRNTWYLFQVTDANGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCVSASSQPLGPRQSIRPGGHVFLGLDAEQGKPVSFDLQQAHIYCDP
MW: 30.3 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Involved in mediating cell attachment and inducing integrin-mediated cellular reactions, such as cell spreading and alterations in cell morphology.
Reference:
Function:
