Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 3(Cmtm3)

Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 3(Cmtm3)

SKU:CSB-CF860813MO

Regular price $1,783.00 USD
Regular price Sale price $1,783.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q99LJ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWPPDAEPEPDPESAHGPRSGRTVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYV VSSASAFLTVPLLEFLLAVYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFVISITA VAKYSDGAYKAAGVFGFFATIVFAIDFYLIFNEVAKFLKQGDSGNETTAHRTEEENSNSD SDSD

Protein Names:Recommended name: CKLF-like MARVEL transmembrane domain-containing protein 3 Alternative name(s): Chemokine-like factor superfamily member 3

Gene Names:Name:Cmtm3 Synonyms:Cklfsf3

Expression Region:1-184

Sequence Info:full length protein

View full details