Recombinant Mouse Chymotrypsin-like elastase family member 2A(Cela2a)

Recombinant Mouse Chymotrypsin-like elastase family member 2A(Cela2a)

CSB-EP005196MO
Regular price
$677.00 USD
Sale price
$677.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: Cela2a

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P05208

AA Sequence: VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

Tag info: N-terminal 6xHis-tagged

Expression Region: 31-271aa

Protein length: Full Length

MW: 29.7 kDa

Alternative Name(s): Elastase-2Elastase-2A

Relevance: Acts upon elastin.

Reference: Sequence organisation and transcriptional regulation of the mouse elastase II and trypsin genes.Stevenson B.J., Hagenbuechle O., Wellauer P.K.Nucleic Acids Res. 14:8307-8330(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share