Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Chitinase domain-containing protein 1(Chid1)

Recombinant Mouse Chitinase domain-containing protein 1(Chid1)

SKU:CSB-MP835645MO

Regular price $2,100.00 USD
Regular price Sale price $2,100.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Immunology

Uniprot ID:Q922Q9

Gene Names:Chid1

Organism:Mus musculus (Mouse)

AA Sequence:TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL

Expression Region:20-393aa

Sequence Info:Full Length of Mature Protein

Source:Mammalian cell

Tag Info:N-terminal 6xHis-Myc-tagged

MW:46.9

Alternative Name(s):Chid1Chitinase domain-containing protein 1

Relevance:Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose

Reference:"A large-scale, gene-driven mutagenesis approach for the functional analysis of the mouse genome." Hansen J., Floss T., Van Sloun P., Fuchtbauer E.M., Vauti F., Arnold H.H., Schnutgen F., Wurst W., von Melchner H., Ruiz P. Proc. Natl. Acad. Sci. U.S.A. 100:9918-9922(2003)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details