Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse CD83 antigen(Cd83)

Recombinant Mouse CD83 antigen(Cd83)

SKU:CSB-CF004962MO

Regular price $1,770.00 USD
Regular price Sale price $1,770.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O88324

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV

Protein Names:Recommended name: CD83 antigen Short name= mCD83 Alternative name(s): CD_antigen= CD83

Gene Names:Name:Cd83

Expression Region:22-196

Sequence Info:full length protein

View full details