
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P35762
Gene Names: Cd81
Organism: Mus musculus (Mouse)
AA Sequence: KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
Expression Region: 116-201aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 36.4 kDa
Alternative Name(s): 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1; CD81
Relevance: May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.
Reference: Possible involvement of CD81 in acrosome reaction of sperm in mice.Tanigawa M., Miyamoto K., Kobayashi S., Sato M., Akutsu H., Okabe M., Mekada E., Sakakibara K., Miyado M., Umezawa A., Miyado K.Mol. Reprod. Dev. 75:150-155(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.