Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1(Cnrip1)

Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1(Cnrip1)

SKU:CSB-YP705797MO

Regular price $1,201.00 USD
Regular price Sale price $1,201.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Neuroscience

Uniprot ID:Q5M8N0

Gene Names:Cnrip1

Organism:Mus musculus (Mouse)

AA Sequence:MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL

Expression Region:1-464aa

Sequence Info:Full Length

Source:Yeast

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:22.6 kDa

Alternative Name(s):Cnrip1CB1 cannabinoid receptor-interacting protein 1; CRIP-1

Relevance:Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.

Reference:"CB1 cannabinoid receptor activity is modulated by the cannabinoid receptor interacting protein CRIP 1a." Niehaus J.L., Liu Y., Wallis K.T., Egertova M., Bhartur S.G., Mukhopadhyay S., Shi S., He H., Selley D.E., Howlett A.C., Elphick M.R., Lewis D.L. Mol. Pharmacol. 72:1557-1566(2007)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.

Involvement in disease:

Subcellular Location:

Protein Families:CNRIP family

Tissue Specificity:Highly expressed in brain. Also detected in heart, lung, intestine, kidney, testis, spleen, liver and muscle (at protein level).

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=425666

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:380686

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:25-35 business days

View full details