
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P23953
Gene Names: Ces1c
Organism: Mus musculus (Mouse)
AA Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Expression Region: 19-550aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 85.6 kDa
Alternative Name(s): Liver carboxylesterase NLung surfactant convertasePES-N
Relevance: Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the Extracellular domain metabolism of lung surfactant.
Reference: Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.Bernhard O.K., Kapp E.A., Simpson R.J.J. Proteome Res. 6:987-995(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
- Regular price
- $769.00 USD
- Sale price
- $769.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
- Regular price
- $762.00 USD
- Sale price
- $762.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
- Regular price
- $769.00 USD
- Sale price
- $769.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Carboxylesterase 1C(Ces1c),partial
- Regular price
- $762.00 USD
- Sale price
- $762.00 USD
- Regular price
-
- Unit price
- per
Sold out