Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse C-type lectin domain family 4 member A(Clec4a),partial

Recombinant Mouse C-type lectin domain family 4 member A(Clec4a),partial

SKU:CSB-EP874136MO

Regular price $1,132.00 USD
Regular price Sale price $1,132.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Immunology

Uniprot ID: Q9QZ15

Gene Names: Clec4a

Organism: Mus musculus (Mouse)

AA Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Expression Region: 70-238aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 39.6 kDa

Alternative Name(s): C-type lectin superfamily member 6 Dendritic cell immunoreceptor

Relevance: May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Reference: "DCIR acts as an inhibitory receptor depending on its immunoreceptor tyrosine-based inhibitory motif." Kanazawa N., Okazaki T., Nishimura H., Tashiro K., Inaba K., Miyachi Y. J. Invest. Dermatol. 118:261-266(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details