Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse C-C motif chemokine 4(Ccl4)

Recombinant Mouse C-C motif chemokine 4(Ccl4)

SKU:CSB-RP090694m

Regular price $963.00 USD
Regular price Sale price $963.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P14097

Gene Names: Ccl4

Organism: Mus musculus (Mouse)

AA Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Expression Region: 24-92aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 11.8 kDa

Alternative Name(s): Immune activation protein 2 ;ACT-2 ;ACT2Macrophage inflammatory protein 1-beta ;MIP-1-betaProtein H400SIS-gamma;Small-inducible cytokine A4

Relevance: Monokine with inflammatory and chokinetic properties.

Reference: Resolution of the two components of macrophage inflammatory protein 1, and cloning and characterization of one of those components, macrophage inflammatory protein 1 beta.Sherry B., Tekamp-Olson P., Gallegos C., Bauer D., Davatelis G., Wolpe S.D., Masiarz F., Coit D., Cerami A.J. Exp. Med. 168:2251-2259(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details