Gene Bio Systems
Recombinant Mouse C-C motif chemokine 4(Ccl4)
Recombinant Mouse C-C motif chemokine 4(Ccl4)
SKU:CSB-RP090694m
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P14097
Gene Names: Ccl4
Organism: Mus musculus (Mouse)
AA Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Expression Region: 24-92aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.8 kDa
Alternative Name(s): Immune activation protein 2 ;ACT-2 ;ACT2Macrophage inflammatory protein 1-beta ;MIP-1-betaProtein H400SIS-gamma;Small-inducible cytokine A4
Relevance: Monokine with inflammatory and chokinetic properties.
Reference: Resolution of the two components of macrophage inflammatory protein 1, and cloning and characterization of one of those components, macrophage inflammatory protein 1 beta.Sherry B., Tekamp-Olson P., Gallegos C., Bauer D., Davatelis G., Wolpe S.D., Masiarz F., Coit D., Cerami A.J. Exp. Med. 168:2251-2259(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
