Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Angiogenin-4(Ang4)

Recombinant Mouse Angiogenin-4(Ang4)

SKU:CSB-YP661010MOa4

Regular price $962.00 USD
Regular price Sale price $962.00 USD
Sale Sold out
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Cardiovascular

Target / Protein: Ang4

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: Q3TMQ6

AA Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Tag info: N-terminal 6xHis-sumostar-tagged

Expression Region: 25-144aa

Protein length: Full Length of Mature Protein

MW: 29.9 kDa

Alternative Name(s):

Relevance: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro)

Reference: "Angiogenins: a new class of microbicidal proteins involved in innate immunity." Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I. Nat. Immunol. 4:269-273(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)