Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Alpha-2,8-sialyltransferase 8B(St8sia2)

Recombinant Mouse Alpha-2,8-sialyltransferase 8B(St8sia2)

SKU:CSB-CF022775MO

Regular price $2,079.00 USD
Regular price Sale price $2,079.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O35696

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT

Protein Names:Recommended name: Alpha-2,8-sialyltransferase 8B EC= 2.4.99.- Alternative name(s): Polysialic acid synthase Sialyltransferase 8B Short name= SIAT8-B Sialyltransferase X Short name= STX Sialytransferase St8Sia II Short name= ST8SiaII

Gene Names:Name:St8sia2 Synonyms:Siat8b, Stx

Expression Region:1-375

Sequence Info:full length protein

View full details