Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse ADP-ATP translocase 1(Slc25a4)

Recombinant Mouse ADP-ATP translocase 1(Slc25a4)

SKU:CSB-CF021510MO

Regular price $1,921.00 USD
Regular price Sale price $1,921.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P48962

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSV QGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Protein Names:Recommended name: ADP/ATP translocase 1 Alternative name(s): ADP,ATP carrier protein 1 ADP,ATP carrier protein, heart/skeletal muscle isoform T1 Adenine nucleotide translocator 1 Short name= ANT 1 Solute carrier family 25 member

Gene Names:Name:Slc25a4 Synonyms:Anc1, Ant1

Expression Region:2-298

Sequence Info:Full length protein

View full details