Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)

Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)

SKU:P27038

Regular price $417.00 USD
Regular price Sale price $417.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Signal Transduction

Uniprot ID: P27038

Gene Names: ACVR2A

Alternative Name(s): Activin receptor type-2A; EC: 2.7.11.30; Activin receptor type IIA (ACTR-IIA); Acvr2a; Acvr2

Abbreviation: Recombinant Mouse ACVR2A protein, partial (Active)

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 20-135aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

MW: 14.8 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2a at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 1.562-1.966 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A. Mediates induction of adipogenesis by GDF6.

Reference: Activin A/ACVR2A axis inhibits epithelial-to-mesenchymal transition in colon cancer by activating SMAD2. Zhang H., Ruan Q., Chen C., Yu H., Guan S., Hu D., Yang C., Lin R., Zhuo C. Mol Carcinog 62: 1585-1598 (2023)

Function:

View full details