
Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q9WV54
Gene Names: Asah1
Organism: Mus musculus (Mouse)
AA Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
Expression Region: 19-141aa
Sequence Info: Partial
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 33.8 kDa
Alternative Name(s): Acylsphingosine deacylase N-acylsphingosine amidohydrolase
Relevance: Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Reference: "Molecular cloning and characterization of a human cDNA and gene encoding a novel acid ceramidase-like protein."Hong S.-B., Li C.-M., Rhee H.-J., Park J.-H., He X., Levy B., Yoo O.J., Schuchman E.H.Genomics 62:232-241(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.