Recombinant Mouse Acid ceramidase(Asah1),partial

Recombinant Mouse Acid ceramidase(Asah1),partial

CSB-CF895296MO
Regular price
$631.00 USD
Sale price
$631.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9WV54

Gene Names: Asah1

Organism: Mus musculus (Mouse)

AA Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM

Expression Region: 19-141aa

Sequence Info: Partial

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 33.8 kDa

Alternative Name(s): Acylsphingosine deacylase N-acylsphingosine amidohydrolase

Relevance: Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.

Reference: "Molecular cloning and characterization of a human cDNA and gene encoding a novel acid ceramidase-like protein."Hong S.-B., Li C.-M., Rhee H.-J., Park J.-H., He X., Levy B., Yoo O.J., Schuchman E.H.Genomics 62:232-241(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.