Gene Bio Systems
Recombinant Mouse 14-3-3 protein beta-alpha(Ywhab)
Recombinant Mouse 14-3-3 protein beta-alpha(Ywhab)
SKU:CSB-YP875120MOa4
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Neuroscience
Uniprot ID: Q9CQV8
Gene Names: Ywhab
Organism: Mus musculus (Mouse)
AA Sequence: MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Expression Region: 1-246aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
MW: 44.1 kDa
Alternative Name(s): Protein kinase C inhibitor protein 1
Relevance: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.
Reference: "Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins." Yuasa K., Ota R., Matsuda S., Isshiki K., Inoue M., Tsuji A. Biochem. Biophys. Res. Commun. 464:70-75(2015)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
