GeneBio Systems
Recombinant Mouse 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial(Cyp24a1)
Recombinant Mouse 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial(Cyp24a1)
SKU:Q64441
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cancer
Uniprot ID: Q64441
Gene Names: Cyp24a1
Alternative Name(s): Cytochrome P450 24A1;Cytochrome P450-CC24;24-OHase; Vitamin D
Abbreviation: Recombinant Mouse Cyp24a1 protein
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 36-514aa
Protein Length: Full Length of Mature Protein
Tag Info: Tag-Free
Target Protein Sequence: RAPKEVPLCPLMTDGETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTESAHPQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFMGQIDELRDERGRIQDLYSELNKWSFESICLVLYEKRFGLLQKDTEEEALTFIAAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDHRLERYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQRLLREIQSVLPDNQTPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYTLPKGTVLTLNTQVLGSSEDNFEDADKFRPERWLEKEKKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIIQKYNIVATDSEPVEMLHLGILVPSRELPIAFCPR
MW: 55.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20ā/-80ā. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20ā/-80ā. The shelf life of lyophilized form is 12 months at -20ā/-80ā.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
Relevance: A cytochrome P450 monooxygenase with a key role in vitamin D catabolism and calcium homeostasis. Via C24-oxidation pathway, catalyzes the inactivation of both the vitamin D precursor calcidiol (25-hydroxyvitamin D(3)) and the active hormone calcitriol (1-alpha,25-dihydroxyvitamin D(3)). With initial hydroxylation at C-24 (via C24-oxidation pathway), performs a sequential 6-step oxidation of calcitriol leading to the formation of the biliary metabolite calcitroic acid. Hydroxylates at C-24 or C-25 other vitamin D active metabolites, such as CYP11A1-derived secosteroids 20S-hydroxycholecalciferol and 20S,23-dihydroxycholecalciferol. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via FDXR/adrenodoxin reductase and FDX1/adrenodoxin.
Reference:
Function:
