Skip to product information
1 of 1

Gene Bio Systems

Recombinant Moorella thermoacetica UPF0059 membrane protein Moth_2394(Moth_2394)

Recombinant Moorella thermoacetica UPF0059 membrane protein Moth_2394(Moth_2394)

SKU:CSB-CF648532MUG

Regular price $1,864.00 USD
Regular price Sale price $1,864.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Moorella thermoacetica (strain ATCC 39073)

Uniprot NO.:Q2RFW3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEPLGLILVAVALGTDAFSLATGLALGGFRGRQAWLFAGTVGLFHIFMPLAGLYLGLLLG RLLGKVAAIIGALVLATMGTLMLWEAYNNRRQGGSMVGQVLRVIPGRGGVLGGVMAILFM AGSVSLDALSVGFGLGAISVNVPLTVLTMGFIAATMTALGLLAGRRLGSFFGNRAELAGG LILVAIGLKMLVGV

Protein Names:Recommended name: UPF0059 membrane protein Moth_2394

Gene Names:Ordered Locus Names:Moth_2394

Expression Region:1-194

Sequence Info:full length protein

View full details