Gene Bio Systems
Recombinant Moorella thermoacetica Glycerol-3-phosphate acyltransferase 1(plsY1)
Recombinant Moorella thermoacetica Glycerol-3-phosphate acyltransferase 1(plsY1)
SKU:CSB-CF647749MUG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Moorella thermoacetica (strain ATCC 39073)
Uniprot NO.:Q2RJ58
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSWTVILTGIFMAYAVGSLAGGHFLSKILYNADVRQVGSGNAGTMNVLRNLGIAAGIMT FIWDTAKGFLVVTLGLKGGGAELGVLMALAAVAGHNWPLYWRFQGGKGLATSLGVALAVY PAAVPPGAALMGLLTFLTRNTDLATLLTFSALPIYFWWREGPGCYLAFGLGLAAIMLLRH GPLVISLFYNLKERR
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 1 Alternative name(s): Acyl-PO4 G3P acyltransferase 1 Acyl-phosphate--glycerol-3-phosphate acyltransferase 1 G3P acyltransferase 1 Short name= GPAT 1 EC= 2.3.1.n3 Lys
Gene Names:Name:plsY1 Ordered Locus Names:Moth_1217
Expression Region:1-195
Sequence Info:full length protein
