Gene Bio Systems
Recombinant Moloney murine leukemia virus Glycosylated Gag polyprotein(gag)
Recombinant Moloney murine leukemia virus Glycosylated Gag polyprotein(gag)
SKU:CSB-CF840805MJAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Moloney murine leukemia virus (strain neuropathogenic variant ts1-92b) (MoMLV)
Uniprot NO.:Q8UN02
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETN VAMSFIWQSAPDIGRKLERLEDLKNKTLGDLVREAERIFNKRETPEEREERIRRETEEKE ERRRTEDEQKEKERDRRRHREMSKLLATVVSGQRQDRQGGERRRSQLDRDQCAYCKEKGH WAKDCPKKPRGPRGPRPQTSLLTLDD
Protein Names:Recommended name: Glycosylated Gag polyprotein Short name= Pr80gag Alternative name(s): Glyco-gag gp80gag Cleaved into the following 2 chains: 1. Nextended-MA-p12 2. CA-NC
Gene Names:Name:gag
Expression Region:430-626
Sequence Info:full length protein
