Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mitochondrial inner membrane organizing system protein F54A3.5(F54A3.5)

Recombinant Mitochondrial inner membrane organizing system protein F54A3.5(F54A3.5)

SKU:CSB-CF885645CXY

Regular price $1,689.00 USD
Regular price Sale price $1,689.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q9N4K0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPGASAPAASRSEDEVGQKIDRCFADSLLKVTGGVAIGIVASVAFFKSRSWPIWFGSGV GLGTGWSNCRHDFASPYVLHGKRVPAGQDSQGKPAYNIITEQHKQ

Protein Names:Recommended name: Mitochondrial inner membrane organizing system protein F54A3.5

Gene Names:ORF Names:F54A3.5

Expression Region:1-105

Sequence Info:full length protein

View full details