Gene Bio Systems
Recombinant Mitochondrial import receptor subunit TOM20 homolog(tomm-20)
Recombinant Mitochondrial import receptor subunit TOM20 homolog(tomm-20)
SKU:CSB-CF024046CXX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Caenorhabditis briggsae
Uniprot NO.:A8Y3V5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTDTLFGFNKSNVVLAAGVAGAAFLGYCIYFDHKRINAPDYKDKIRQKRRAQAGSGGMAARRPPAGGNEMAPDVTDPSQMQRFFLQEVQLGEELMAAGNVEEGAVHIANAVMLCGESQQLLSIFQQTLSEEQFRAVVQQLPSTRERLADMFGARADEAENEPPLVQYLGDGPPPAQIQELIDDTDDLE
Protein Names:Recommended name: Mitochondrial import receptor subunit TOM20 homolog Alternative name(s): Translocase of outer mitochondrial membrane protein 20
Gene Names:Name:tomm-20 ORF Names:CBG23457
Expression Region:1-188
Sequence Info:full length protein
