Recombinant Mitochondrial import inner membrane translocase subunit TIM14(dnj-21)

SKU: CSB-CF007026CXY

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:P91454

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTGGLIVAGLGLAAVGFGARYVLRNQALIKKGMEAIPVAGGAFSNYYRGGFDQKMSRAEAAKILGVAPSAKPAKIKEAHKKVMIVNHPDRGGSPYLAAKINEAKDLMESSKS

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM14 Alternative name(s): DnaJ homolog subfamily C member 21

Gene Names:Name:dnj-21 Synonyms:tim-14 ORF Names:T19B4.4

Expression Region:1-112

Sequence Info:full length protein