Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mitochondrial fission process protein 1(mtp-18)

Recombinant Mitochondrial fission process protein 1(mtp-18)

SKU:CSB-CF840540CXY

Regular price $1,760.00 USD
Regular price Sale price $1,760.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q8T3C8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPVEEIIKKDIFRETPLRYLGYANEVGEAFRSLVKPVVVKFSYVVAFGYVAADSIDKGL QEYIKTHSTSTEKTKKVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTN MRKWTVTCLGLATIPFIVHPIDSFVEEAMDKTARKIYNEPTISNKE

Protein Names:Recommended name: Mitochondrial fission process protein 1 Alternative name(s): Mitochondrial 18 kDa protein Short name= MTP18

Gene Names:Name:mtp-18 ORF Names:T13C5.8

Expression Region:1-166

Sequence Info:full length protein

View full details