Recombinant Methanothermobacter marburgensis Cobalt transport protein CbiN(cbiN)

SKU: CSB-CF687382MSQ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Uniprot NO.:Q50799

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDKRHTIMLIAVAVIAIAPLVIYSGLGEDQGYFGGADDSASKAISETGYKPWFQPIWEPP SGEIESLLFALQAAIGALIIGYVFGYYRGRGESPE

Protein Names:Recommended name: Cobalt transport protein CbiN Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiN Short name= ECF transporter S component CbiN

Gene Names:Name:cbiN Ordered Locus Names:MTBMA_c05810

Expression Region:1-95

Sequence Info:full length protein