Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanospirillum hungatei UPF0316 protein Mhun_0543(Mhun_0543)

Recombinant Methanospirillum hungatei UPF0316 protein Mhun_0543(Mhun_0543)

SKU:CSB-CF643911MAAQ

Regular price $1,803.00 USD
Regular price Sale price $1,803.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanospirillum hungatei (strain JF-1 / DSM 864)

Uniprot NO.:Q2FLQ6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVGFLSSDLFTFGLIPVLIFLARICDVSIGTIRYIMISRGFKFIAPVFGFFEVTIWLLA IGQVMANITNPICYIAYGAGFAAGTYIGMELEERMKLGMAIIRLITPLPTEDFIARLRQY GYGVTNITAQGANGEVTIIFMVVKRAKIPHLAILIRDFNPHAFYTIEDVRSASEGIYPIE DKNNPFSIFKRPFLFIGKRK

Protein Names:Recommended name: UPF0316 protein Mhun_0543

Gene Names:Ordered Locus Names:Mhun_0543

Expression Region:1-200

Sequence Info:full length protein

View full details