Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosarcina acetivorans UPF0059 membrane protein MA_3749(MA_3749)

Recombinant Methanosarcina acetivorans UPF0059 membrane protein MA_3749(MA_3749)

SKU:CSB-CF823513MFB

Regular price $1,855.00 USD
Regular price Sale price $1,855.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Uniprot NO.:Q8TJN1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFLTNFLLGLGLAMDAFAVSMSSGTTIRPFRVSDALKLAVFFGSFQAMMPVLGWIGGST VSSFVSDYAPWIAFLLLAFIGCKMIYEALYGDQDGKVNSLNYSVLFLLAVATSIDALAVG MSFAFLGTPILEPVIIIGCVTFVMSFCGAILGYRLGHFFEHEVEILGGLILIGLGGKILA EHMLWI

Protein Names:Recommended name: UPF0059 membrane protein MA_3749

Gene Names:Ordered Locus Names:MA_3749

Expression Region:1-186

Sequence Info:full length protein

View full details