Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit F(mtrF)

Recombinant Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit F(mtrF)

SKU:CSB-CF819573MSI

Regular price $1,500.00 USD
Regular price Sale price $1,500.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

Uniprot NO.:Q8TVA7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEEGSELKEVIIGAPAMADTDRADTYVNDVRDSSQFFGRDARLYFGLNVNRFAGLACGM VFAGVLLVPLLLLAF

Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit F EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit F

Gene Names:Name:mtrF Ordered Locus Names:MK1485

Expression Region:1-75

Sequence Info:full length protein

View full details