Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanococcus vannielii UPF0290 protein Mevan_1000 (Mevan_1000)

Recombinant Methanococcus vannielii UPF0290 protein Mevan_1000 (Mevan_1000)

SKU:CSB-CF413496MNS

Regular price $1,778.00 USD
Regular price Sale price $1,778.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224)

Uniprot NO.:A6UQY1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLINLLFVSFWFILPAYTANAMACIFGGGKPVDLNKNFIDQKRLIGNGVTYRGTFFGVF FGIVTAIIQYLVSNLGFKFILSFNFTLIEYVIIGFLLSFGALFGDMFGSFLKRRLGFKQG QSAPVLDQITFIVFALIFVSYYYLVPSKISITLLILSPVVHILSNIIAYKLGLKKVWW

Protein Names:Recommended name: UPF0290 protein Mevan_1000

Gene Names:Ordered Locus Names:Mevan_1000

Expression Region:1-178

Sequence Info:full length protein

View full details