Gene Bio Systems
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1155.1 (MJ1155.1)
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1155.1 (MJ1155.1)
SKU:CSB-CF305866MRU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Uniprot NO.:P81316
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDKNILAIIFVAVGTYLIRYIPIHLHSKIKNIDEKVKEINEILIYSSTSVISALFITSFI KFPIIFSNVLISTISLIFAIVSYKKWNNLGISILISVVIYYLASKFLISI
Protein Names:Recommended name: Uncharacterized protein MJ1155.1
Gene Names:Ordered Locus Names:MJ1155.1
Expression Region:1-110
Sequence Info:full length protein
