Skip to product information
1 of 1

Gene Bio Systems

Recombinant Meriones unguiculatus Monocarboxylate transporter 1(SLC16A1)

Recombinant Meriones unguiculatus Monocarboxylate transporter 1(SLC16A1)

SKU:CSB-CF021403MRA

Regular price $1,651.00 USD
Regular price Sale price $1,651.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)

Uniprot NO.:O35439

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LSILAFVDMVARPSMGLAANTKWIRPRIQYFFAASVVANGVCHLLAPLSTSYIGFCVYAG VFGFAFGWLSSVLFET

Protein Names:Recommended name: Monocarboxylate transporter 1 Short name= MCT 1 Alternative name(s): Solute carrier family 16 member 1

Gene Names:Name:SLC16A1 Synonyms:MCT1

Expression Region:1-76

Sequence Info:full length protein

View full details