Gene Bio Systems
Recombinant Meriones unguiculatus Beta-1 adrenergic receptor(ADRB1)
Recombinant Meriones unguiculatus Beta-1 adrenergic receptor(ADRB1)
SKU:CSB-CF001391MRA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Uniprot NO.:O70430
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ISALVSFLPILMHWWRAENDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVY LRVFREAQKQVKK
Protein Names:Recommended name: Beta-1 adrenergic receptor Alternative name(s): Beta-1 adrenoreceptor Short name= Beta-1 adrenoceptor
Gene Names:Name:ADRB1
Expression Region:1-73
Sequence Info:full length protein
