Skip to product information
1 of 1

Gene Bio Systems

Recombinant Marinobacter aquaeolei Electron transport complex protein RnfE(rnfE)

Recombinant Marinobacter aquaeolei Electron transport complex protein RnfE(rnfE)

SKU:CSB-CF378850MNI

Regular price $1,913.00 USD
Regular price Sale price $1,913.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) (Marinobacter hydrocarbonoclasticus (strain DSM 11845))

Uniprot NO.:A1TZ60

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTKTSSEIIKDGLWHNNPALVQVLGLCPLLAVTSTVVNAIGLGLATLLVLMGSNLSVSL IRNFVSESVRLPAFVMIIASFVTCAELLMQAFTYELYQILGIFIPLIVTNCAILGRADAF ASKNPPLPAILDGAMMGIGFLAVLMTLGAMRELIGQGTLFADMHLLLGPMAADWVIRPLE QYPDMLFMVLPPGAFVGLGLLIALKNGIDNHLKERRKAAEPAPASTGSKRVRVTGTIS

Protein Names:Recommended name: Electron transport complex protein RnfE Alternative name(s): Nitrogen fixation protein RnfE

Gene Names:Name:rnfE Ordered Locus Names:Maqu_0933

Expression Region:1-238

Sequence Info:full length protein

View full details