Skip to product information
1 of 1

Gene Bio Systems

Recombinant Manduca sexta ATP synthase lipid-binding protein, mitochondrial

Recombinant Manduca sexta ATP synthase lipid-binding protein, mitochondrial

SKU:CSB-CF886978MPV

Regular price $1,704.00 USD
Regular price Sale price $1,704.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Uniprot NO.:Q9U505

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMMAFLLLFAF

Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATPase protein 9 ATPase subunit c

Gene Names:

Expression Region:57-131

Sequence Info:full length protein

View full details